HORDB

ID: hor004653
Uniprot ID: Q29PU4
Protein name: CLAVATA3/ESR (CLE)-related protein 12
Gene name: CLE12
Organism: Arabidopsis thaliana (Mouse-ear cress)
Family: CLV3/ESR signal peptide family
Source: Plant
Expression: [CLE12p]: Mostly expressed in seedlings, roots, flowers, stems and apex, and, to a lower extent, in leaves and siliques.
Disease: NA
Comments: NA
Taxonomy: Arabidopsis (genus), Camelineae (tribe), Brassicaceae (family), Brassicales (order), malvids, rosids, Pentapetalae, Gunneridae, eudicotyledons, Mesangiospermae, Magnoliopsida (class), Spermatophyta, Euphyllophyta, Tracheophyta, Embryophyta, Streptophytina (subphylum), Streptophyta (phylum), Viridiplantae (kingdom), Eukaryota (superkingdom), cellular organisms
GO MF: GO:0033612 receptor serine/threonine kinase binding
GO BP: GO:0030154 cell differentiation; GO:0045168 cell-cell signaling involved in cell fate commitment
GO CC: GO:0005576 extracellular region; GO:0048046 apoplast

Sequence: SLNFRRLYSLNAVEPSLLKQHYRSYRLVSRKVLSDRFDFTPFHSRDNSRHNHRSGEQYDGDEIDPRYGVEKRRVPSGPNPLHH
Length: 83
Propeptide: MLRISSSSSMALKFSQILFIVLWLSLFFLLLHHLYSLNFRRLYSLNAVEPSLLKQHYRSYRLVSRKVLSDRFDFTPFHSRDNSRHNHRSGEQYDGDEIDPRYGVEKRRVPSGPNPLHH
Signal peptide: MLRISSSSSMALKFSQILFIVLWLSLFFLLLHHLY
Modification: T75 Hydroxyproline;T78 Hydroxyproline
Glycosylation: T78 O-linked (Ara...) hydroxyproline
Mutagenesis: NA

Function: Extracellular signal peptide that regulates cell fate. Represses root apical meristem maintenance.
Mechanism: NA
Cross BBB: NA
Target: NA
Target Unid: NA
IC50: NA
EC50: NA
ED50: NA
kd: NA
Half life: NA

Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)

hor004653_AF2.pdb

hor004653_ESM.pdb

Mass:	1136869	Formula:	C435H669N141O127
Absent amino acids:	CMW	Common amino acids:	R
pI:	10.34	Basic residues:	21
Polar residues:	25	Hydrophobic residues:	19
Hydrophobicity:	-122.77	Boman Index:	-30279
Half-Life:	1.9 hour	Half-Life Yeast:	>20 hour
Half-Life E.Coli:	>10 hour	Aliphatic Index	60.96
Instability Index:	6420.24	Extinction Coefficient cystines:	7450
Absorbance 280nm:	90.85